PDB entry 1nmu

View 1nmu on RCSB PDB site
Description:
Deposited on 2003-01-10, released 2003-02-18
The last revision prior to the SCOP 1.65 freeze date was dated 2003-02-18, with a file datestamp of 2003-02-18.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.214
AEROSPACI score: -1.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1nmua_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1nmub_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1nmuc_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1nmud_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nmuA (A:)
    mkieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdi
    ifwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynk
    dllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydik
    dvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtsk
    vnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkpl
    gavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvde
    alkdaqtnsssvpgrgsiegra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nmuA (A:)
    eegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifw
    ahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdll
    pnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvg
    vdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvny
    gvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgav
    alksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealk
    daqtnsss
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nmuB (B:)
    apvksqesinqklalviksgkytlgykstvkslrqgkskliiiaantpvlrkseleyyam
    lsktkvyyfqggnnelgtavgklfrvgvvsileagdsdilttla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nmuC (C:)
    mkieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdi
    ifwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynk
    dllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydik
    dvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtsk
    vnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkpl
    gavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvde
    alkdaqtnsssvpgrgsiegra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nmuC (C:)
    eegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifw
    ahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdll
    pnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvg
    vdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvny
    gvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgav
    alksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealk
    daqtnsss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nmuD (D:)
    apvksqesinqklalviksgkytlgykstvkslrqgkskliiiaantpvlrkseleyyam
    lsktkvyyfqggnnelgtavgklfrvgvvsileagdsdilttla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nmuD (D:)
    pvksqesinqklalviksgkytlgykstvkslrqgkskliiiaantpvlrkseleyyaml
    sktkvyyfqggnnelgtavgklfrvgvvsileagdsdilttla