PDB entry 1nmr

View 1nmr on RCSB PDB site
Description: solution structure of c-terminal domain from trypanosoma cruzi poly(a)-binding protein
Deposited on 2003-01-10, released 2003-09-09
The last revision prior to the SCOP 1.69 freeze date was dated 2003-11-04, with a file datestamp of 2003-11-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1nmra_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nmrA (A:)
  gsslasqgqnlstvlanltpeqqknvlgerlynhivainpaaaakvtgmllemdngeiln
  lldtpglldakvqealevlnrhmnv