PDB entry 1nmn

View 1nmn on RCSB PDB site
Description: Structure of yqgF from Escherichia coli, a hypothetical protein
Deposited on 2003-01-10, released 2004-03-02
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-02, with a file datestamp of 2004-03-02.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.196
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1nmna_
  • Chain 'B':
    Domains in SCOP 1.67: d1nmnb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nmnA (A:)
    msgtllafdfgtksigvavgqritgtarplpaikaqdgtpdwniierllkewqpdeiivg
    lplnmdgteqpltararkfanrihgrfgvevklhderlstvearsglfeqggyralnkgk
    vdsasaviilesyfeqgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nmnA (A:)
    sgtllafdfgtksigvavgqritgtarplpaikaqdgtpdwniierllkewqpdeiivgl
    plnmdgteqpltararkfanrihgrfgvevklhderlstvgkvdsasaviilesyfeqgy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nmnB (B:)
    msgtllafdfgtksigvavgqritgtarplpaikaqdgtpdwniierllkewqpdeiivg
    lplnmdgteqpltararkfanrihgrfgvevklhderlstvearsglfeqggyralnkgk
    vdsasaviilesyfeqgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nmnB (B:)
    sgtllafdfgtksigvavgqritgtarplpaikaqdgtpdwniierllkewqpdeiivgl
    plnmdgteqpltararkfanrihgrfgvevklhderlstvdsasaviilesyfeqgy