PDB entry 1nml

View 1nml on RCSB PDB site
Description: Di-haemic Cytochrome c Peroxidase from Pseudomonas nautica 617, form IN (pH 4.0)
Class: oxidoreductase
Keywords: oxidoreductase, peroxidase, di-haem, electron transport
Deposited on 2003-01-10, released 2004-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.179
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: di-haem cytochrome c peroxidase
    Species: Marinobacter hydrocarbonoclasticus [TaxId:2743]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nmla1, d1nmla2
  • Heterogens: HEM, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nmlA (A:)
    dnlmeransmfepipkyppvidgneltqakvelgkmeffeprlssshliscntchnvglg
    gddelptsighgwqkgprnsptvfnavfnaaqfwdgraadlaeqakgpvqagvemsstpd
    rvvatlksmpeyierfedafpgqenpvtfdnmavaieayeatlitpeapfdkylrgdtsa
    lnesekeglalfmdrgctachsgvnlggqnyypfglvakpgaeilpegdkgrfsvtetas
    deyvfrasplrnieltapyfhsgavwsleeavavmgtaqlgtelnndevksivaflktlt
    gnvpevtypvlppstantpkpvdmip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nmlA (A:)
    dnlmeransmfepipkyppvidgneltqakvelgkmeffeprlssshliscntchnvglg
    gddelptsighgwqkgprnsptvfnavfnaaqfwdgraadlaeqakgpvqagvemsstpd
    rvvatlksmpeyierfedafpgqenpvtfdnmavaieayeatlitpeapfdkylrgdtsa
    lnesekeglalfmdrgctachsgvnlggqnyypfglvakkgrfsvtetasdeyvfraspl
    rnieltapyfhsgavwsleeavavmgtaqlgtelnndevksivaflktltgnvpevtypv
    lppstantpkpvdmip