PDB entry 1nml

View 1nml on RCSB PDB site
Description: di-haemic cytochrome c peroxidase from pseudomonas nautica 617, form in (ph 4.0)
Deposited on 2003-01-10, released 2004-01-13
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-13, with a file datestamp of 2004-01-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.179
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nmlA (A:)
    dnlmeransmfepipkyppvidgneltqakvelgkmeffeprlssshliscntchnvglg
    gddelptsighgwqkgprnsptvfnavfnaaqfwdgraadlaeqakgpvqagvemsstpd
    rvvatlksmpeyierfedafpgqenpvtfdnmavaieayeatlitpeapfdkylrgdtsa
    lnesekeglalfmdrgctachsgvnlggqnyypfglvakpgaeilpegdkgrfsvtetas
    deyvfrasplrnieltapyfhsgavwsleeavavmgtaqlgtelnndevksivaflktlt
    gnvpevtypvlppstantpkpvdmip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nmlA (A:)
    dnlmeransmfepipkyppvidgneltqakvelgkmeffeprlssshliscntchnvglg
    gddelptsighgwqkgprnsptvfnavfnaaqfwdgraadlaeqakgpvqagvemsstpd
    rvvatlksmpeyierfedafpgqenpvtfdnmavaieayeatlitpeapfdkylrgdtsa
    lnesekeglalfmdrgctachsgvnlggqnyypfglvakkgrfsvtetasdeyvfraspl
    rnieltapyfhsgavwsleeavavmgtaqlgtelnndevksivaflktltgnvpevtypv
    lppstantpkpvdmip