PDB entry 1nmi

View 1nmi on RCSB PDB site
Description: Solution structure of the imidazole complex of iso-1 cytochrome c
Class: electron transport
Keywords: ligand-protein complex, ELECTRON TRANSPORT
Deposited on 2003-01-10, released 2003-02-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c, iso-1
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00044 (0-107)
    • conflict (106)
  Domains in SCOPe 2.04: d1nmia_
• Heterogens: IMD, HEC

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nmiA (A:)
  tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
  nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate