PDB entry 1nmi

View 1nmi on RCSB PDB site
Description: Solution structure of the imidazole complex of iso-1 cytochrome c
Class: electron transport
Keywords: ligand-protein complex, ELECTRON TRANSPORT
Deposited on 2003-01-10, released 2003-02-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c, iso-1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (0-107)
      • conflict (106)
    Domains in SCOPe 2.08: d1nmia_
  • Heterogens: IMD, HEC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nmiA (A:)
    tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate