PDB entry 1nmg

View 1nmg on RCSB PDB site
Description: major cold-shock protein, nmr, minimized average structure
Class: transcription regulation
Keywords: cold shock protein, transcription regulation
Deposited on 1996-02-05, released 1996-07-11
The last revision prior to the SCOP 1.73 freeze date was dated 1996-07-11, with a file datestamp of 2007-06-04.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major cold-shock protein
    Species: Bacillus subtilis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1nmga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nmgA (A:)
    mlegkvkwfnsekgfgfievegqddvfvhfsaiqgegfktleegqavsfeivegnrgpqa
    anvtkea