PDB entry 1nmg

View 1nmg on RCSB PDB site
Description: major cold-shock protein, nmr, minimized average structure
Class: transcription regulation
Keywords: cold shock protein, transcription regulation
Deposited on 1996-02-05, released 1996-07-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: major cold-shock protein
  Species: Bacillus subtilis [TaxId:1423]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P32081 (0-66)
  Domains in SCOPe 2.08: d1nmga_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nmgA (A:)
  mlegkvkwfnsekgfgfievegqddvfvhfsaiqgegfktleegqavsfeivegnrgpqa
  anvtkea