PDB entry 1nmf

View 1nmf on RCSB PDB site
Description: major cold-shock protein, nmr, 20 structures
Class: transcription regulation
Keywords: cold shock protein, transcription regulation
Deposited on 1996-02-05, released 1996-07-11
The last revision prior to the SCOP 1.73 freeze date was dated 1996-07-11, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major cold-shock protein
    Species: Bacillus subtilis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1nmfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1nmfA (A:)
mlegkvkwfnsekgfgfievegqddvfvhfsaiqgegfktleegqavsfeivegnrgpqa
anvtkea