PDB entry 1nmf

View 1nmf on RCSB PDB site
Description: major cold-shock protein, nmr, 20 structures
Deposited on 1996-02-05, released 1996-07-11
The last revision prior to the SCOP 1.71 freeze date was dated 1996-07-11, with a file datestamp of 1996-07-11.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.71: d1nmf__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nmf_ (-)
  mlegkvkwfnsekgfgfievegqddvfvhfsaiqgegfktleegqavsfeivegnrgpqa
  anvtkea