PDB entry 1nmc

View 1nmc on RCSB PDB site
Description: complex between nc10 anti-influenza virus neuraminidase single chain antibody with a 15 residue linker and influenza virus neuraminidase
Class: complex (single-chain antibody/antigen)
Keywords: complex (single-chain antibody/antigen), hydrolase
Deposited on 1997-12-21, released 1998-09-23
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.22
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: INFLUENZA A VIRUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1nmca_
  • Chain 'B':
    Compound: single chain antibody
    Species: MUS MUSCULUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAA19165 (0-117)
    Domains in SCOP 1.75: d1nmcb_
  • Chain 'C':
    Compound: single chain antibody
    Species: MUS MUSCULUS
    Gene:
    Domains in SCOP 1.75: d1nmcc_
  • Chain 'H':
    Compound: single chain antibody
    Species: MUS MUSCULUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAA19165 (0-117)
    Domains in SCOP 1.75: d1nmch_
  • Chain 'L':
    Compound: single chain antibody
    Species: MUS MUSCULUS
    Gene:
    Domains in SCOP 1.75: d1nmcl_
  • Chain 'N':
    Compound: Neuraminidase
    Species: INFLUENZA A VIRUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1nmcn_
  • Heterogens: MAN, NAG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nmcA (A:)
    rdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
    gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnn
    asaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkeg
    kilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicsp
    vltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpn
    altddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
    nsivsmcssteflgqwdwpdgakieyfl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nmcB (B:)
    qvqlqqsgaelvkpgasvrmsckasgytftnynmywvkqspgqglewigifypgngdtsy
    nqkfkdkatltadkssntaymqlssltsedsavyycarsggsyrydggfdywgqgttvtv
    ss
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nmcC (C:)
    dieltqttsslsaslgdrvtiscrasqdisnylnwyqqnpdgtvklliyytsnlhsevps
    rfsgsgsgtdysltisnleqediatyfcqqdftlpftfgggtkleirdy
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nmcH (H:)
    qvqlqqsgaelvkpgasvrmsckasgytftnynmywvkqspgqglewigifypgngdtsy
    nqkfkdkatltadkssntaymqlssltsedsavyycarsggsyrydggfdywgqgttvtv
    ss
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nmcL (L:)
    dieltqttsslsaslgdrvtiscrasqdisnylnwyqqnpdgtvklliyytsnlhsevps
    rfsgsgsgtdysltisnleqediatyfcqqdftlpftfgggtkleirdy
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nmcN (N:)
    rdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
    gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnn
    asaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkeg
    kilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicsp
    vltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpn
    altddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
    nsivsmcssteflgqwdwpdgakieyfl