PDB entry 1nma

View 1nma on RCSB PDB site
Description: n9 neuraminidase complexes with antibodies nc41 and nc10: empirical free-energy calculations capture specificity trends observed with mutant binding data
Class: complex (hydrolase/immunoglobulin)
Keywords: complex (hydrolase/immunoglobulin)
Deposited on 1994-05-06, released 1995-09-15
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.2
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: fab nc10
    Species: Mus musculus
    Gene:
    Domains in SCOP 1.75: d1nmah_
  • Chain 'L':
    Compound: fab nc10
    Species: Mus musculus
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAA19165 (1-End)
      • conflict (2-3)
      • conflict (6)
      • conflict (108)
    Domains in SCOP 1.75: d1nmal_
  • Chain 'N':
    Compound: n9 neuraminidase
    Species: INFLUENZA VIRUS A/WHALE/MAINE/1/84 ISOLATED FROM PILOT WHALE (GLOBICEPHALA MELAENA)
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05803 (0-End)
      • conflict (305)
      • conflict (307)
    Domains in SCOP 1.75: d1nman_
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nmaH (H:)
    evqlqqpgaelvkpgasvrmsckasgytftnynmywvkqspgqglewigifypgngdtsy
    nqkfkdkatltadkssntaymqlssltsedsavyycarsggsyrydggfdywgqgttltv
    ss
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nmaL (L:)
    diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqnpdgtvklliyytsnlhsevps
    rfsgsgsgtdysltisnleqediatyfcqqdftlpftfgggtkleirra
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1nmaN (N:)
    refnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
    gkhsngtihdrsqyrdliswplsspptvynsrvecigwsstschdgrarmsicisgpnnn
    asaviwynrrpvteintwarnilrtqesecvcqngvcpvvftdgsatgpaetriyyfkeg
    kilkwepltgtakhieecscygeqagvtctcrdnwqgsnrpviqidpvamthtsqyicsp
    vltdnprpndptvgkcndpypgnnnngvkgfsyldggntwlgrtisiasrsgyemlkvpn
    altddksrptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
    nsivsmcssteflgqwnwpdgakieyfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nmaN (N:)
    refnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
    gkhsngtihdrsqyrdliswplsspptvynsrvecigwsstschdgrarmsicisgpnnn
    asaviwynrrpvteintwarnilrtqesecvcqngvcpvvftdgsatgpaetriyyfkeg
    kilkwepltgtakhieecscygeqagvtctcrdnwqgsnrpviqidpvamthtsqyicsp
    vltdnprpndptvgkcndpypgnnnngvkgfsyldggntwlgrtisiasrsgyemlkvpn
    altddksrptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
    nsivsmcssteflgqwnw