PDB entry 1nm9

View 1nm9 on RCSB PDB site
Description: Crystal structure of recombinant human salivary amylase mutant W58A
Class: hydrolase
Keywords: C-H... hydrogen bond, tim barrel, catalysis, HYDROLASE
Deposited on 2003-01-09, released 2004-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.162
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-amylase, salivary
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04745 (0-495)
      • modified residue (0)
      • engineered (57)
    Domains in SCOPe 2.07: d1nm9a1, d1nm9a2
  • Heterogens: GLC, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nm9A (A:)
    eyssntqqgrtsivhlfewrwvdialecerylapkgfggvqvsppnenvaihnpfrpawe
    ryqpvsyklctrsgnedefrnmvtrcnnvgvriyvdavinhmcgnavsagtsstcgsyfn
    pgsrdfpavpysgwdfndgkcktgsgdienyndatqvrdcrlsglldlalgkdyvrskia
    eymnhlidigvagfridaskhmwpgdikaildklhnlnsnwfpegskpfiyqevidlgge
    pikssdyfgngrvtefkygaklgtvirkwngekmsylknwgegwgfmpsdralvfvdnhd
    nqrghgaggasiltfwdarlykmavgfmlahpygftrvmssyrwpryfengkdvndwvgp
    pndngvtkevtinpdttcgndwvcehrwrqirnmvnfrnvvdgqpftnwydngsnqvafg
    rgnrgfivfnnddwtfsltlqtglpagtycdvisgdkingnctgikiyvsddgkahfsis
    nsaedpfiaihaeskl