PDB entry 1nm7

View 1nm7 on RCSB PDB site
Description: Solution structure of the ScPex13p SH3 domain
Class: protein transport
Keywords: Yeast, Membrane protein, Pex5p, Pex14p, Pex13p, import machine, SH3 domain, PROTEIN TRANSPORT
Deposited on 2003-01-09, released 2003-03-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: peroxisomal membrane protein pas20
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P80667 (8-68)
  Domains in SCOPe 2.05: d1nm7a_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1nm7A (A:)
  gshhhhhhfaralydfvpenpemevalkkgdlmailskkdplgrdsdwwkvrtkngnigy
  ipynyieii
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1nm7A (A:)
  faralydfvpenpemevalkkgdlmailskkdplgrdsdwwkvrtkngnigyipynyiei
  i