PDB entry 1nm7

View 1nm7 on RCSB PDB site
Description: Solution structure of the ScPex13p SH3 domain
Class: protein transport
Keywords: Yeast, Membrane protein, Pex5p, Pex14p, Pex13p, import machine, SH3 domain, PROTEIN TRANSPORT
Deposited on 2003-01-09, released 2003-03-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peroxisomal membrane protein pas20
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nm7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nm7A (A:)
    gshhhhhhfaralydfvpenpemevalkkgdlmailskkdplgrdsdwwkvrtkngnigy
    ipynyieii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nm7A (A:)
    faralydfvpenpemevalkkgdlmailskkdplgrdsdwwkvrtkngnigyipynyiei
    i