PDB entry 1nm5

View 1nm5 on RCSB PDB site
Description: R. rubrum transhydrogenase (dI.Q132N)2(dIII)1 asymmetric complex
Class: oxidoreductase
Keywords: asymmetric complex, Rossman domain, OXIDOREDUCTASE
Deposited on 2003-01-09, released 2004-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.238
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD(P) transhydrogenase subunit alpha part 1
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: PNT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60164 (0-End)
      • engineered (131)
    Domains in SCOPe 2.08: d1nm5a1, d1nm5a2
  • Chain 'B':
    Compound: NAD(P) transhydrogenase subunit alpha part 1
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: PNT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q60164 (0-End)
      • engineered (131)
    Domains in SCOPe 2.08: d1nm5b1, d1nm5b2
  • Chain 'C':
    Compound: NAD(P) transhydrogenase subunit beta
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: PNT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nm5c_
  • Heterogens: NAD, NAP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nm5A (A:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisransmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvddeamktaetaggyakemg
    eefrkkqaeavlkelvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggn
    cplsepgkivvkhgvkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkled
    etvsgtcvtrdgaivhpaltgqga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nm5A (A:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisransmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvakemgeefrkkqaeavlke
    lvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhg
    vkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkledetvsgtcvtrdgai
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nm5B (B:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisransmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvddeamktaetaggyakemg
    eefrkkqaeavlkelvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggn
    cplsepgkivvkhgvkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkled
    etvsgtcvtrdgaivhpaltgqga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nm5B (B:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisransmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvefrkkqaeavlkelvktdi
    aittalipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivgh
    tnvpsrvaadasplfaknllnfltphvdkdtktlvmkledetvsgtcvtrdgaivhpa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nm5C (C:)
    mnrsifnvilggfgseggvaaaggaagdrsvkagsaedaafimknaskviivpgygmava
    qaqhalremadvlkkegvevsyaihpvagrmpghmnvllaeanvpydevfeleeinssfq
    tadvafvigandvtnpaaktdpsspiygmpildvekagtvlfikrsmasgyagvenelff
    rnntmmlfgdakkmteqivqamn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nm5C (C:)
    svkagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpvag
    rmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiygm
    pildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn