PDB entry 1nlw

View 1nlw on RCSB PDB site
Description: Crystal structure of Mad-Max recognizing DNA
Class: transcription/DNA
Keywords: transcription factor, DNA, bHLHZ, TRANSCRIPTION/DNA COMPLEX
Deposited on 2003-01-07, released 2003-02-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.264
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mad protein
    Species: Homo sapiens [TaxId:9606]
    Gene: Mad
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05195
      • engineered (18)
      • variant (31)
      • engineered (54)
    Domains in SCOPe 2.03: d1nlwa_
  • Chain 'B':
    Compound: max protein
    Species: Homo sapiens [TaxId:9606]
    Gene: Max
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1nlwb_
  • Chain 'D':
    Compound: mad protein
    Species: Homo sapiens [TaxId:9606]
    Gene: Mad
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05195 (0-End)
      • engineered (18)
      • variant (31)
      • engineered (54)
    Domains in SCOPe 2.03: d1nlwd_
  • Chain 'E':
    Compound: max protein
    Species: Homo sapiens [TaxId:9606]
    Gene: Max
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1nlwe_
  • Chain 'F':
    Compound: 5'-d(*gp*ap*gp*tp*ap*gp*cp*ap*cp*gp*tp*gp*cp*tp*ap*cp*tp*c)-3'
  • Chain 'G':
    Compound: 5'-d(*gp*ap*gp*tp*ap*gp*cp*ap*cp*gp*tp*gp*cp*tp*ap*cp*tp*c)-3'
  • Chain 'H':
    Compound: 5'-d(*gp*ap*gp*tp*ap*gp*cp*ap*cp*gp*tp*gp*cp*tp*ap*cp*tp*c)-3'
  • Chain 'J':
    Compound: 5'-d(*gp*ap*gp*tp*ap*gp*cp*ap*cp*gp*tp*gp*cp*tp*ap*cp*tp*c)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nlwA (A:)
    srsthnemeknrrahlrlsleklkglvplgpdssrhttlslltkaklhikkledsdrkav
    hqidqlqreqrhlkrqlekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nlwA (A:)
    srsthnemeknrrahlrlsleklkglvplgpdssrhttlslltkaklhikkledsdrkav
    hqidqlqreqrhlkrqlek
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nlwB (B:)
    krahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhthqq
    diddlkrqnalleqqv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nlwD (D:)
    srsthnemeknrrahlrlsleklkglvplgpdssrhttlslltkaklhikkledsdrkav
    hqidqlqreqrhlkrqlekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nlwD (D:)
    srsthnemeknrrahlrlsleklkglvplgpdssrhttlslltkaklhikkledsdrkav
    hqidqlqreqrhlkrql
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1nlwE (E:)
    krahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhthqq
    diddlkrqnalleqqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nlwE (E:)
    ahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhthqqdi
    ddlkrqnalleqqv
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'J':
    No sequence available.