PDB entry 1nlw

View 1nlw on RCSB PDB site
Description: crystal structure of mad-max recognizing dna
Deposited on 2003-01-07, released 2003-02-04
The last revision prior to the SCOP 1.67 freeze date was dated 2003-02-04, with a file datestamp of 2003-02-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.264
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1nlwa_
  • Chain 'B':
    Domains in SCOP 1.67: d1nlwb_
  • Chain 'D':
    Domains in SCOP 1.67: d1nlwd_
  • Chain 'E':
    Domains in SCOP 1.67: d1nlwe_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nlwA (A:)
    srsthnemeknrrahlrlsleklkglvplgpdssrhttlslltkaklhikkledsdrkav
    hqidqlqreqrhlkrqlekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nlwA (A:)
    srsthnemeknrrahlrlsleklkglvplgpdssrhttlslltkaklhikkledsdrkav
    hqidqlqreqrhlkrqlek
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nlwB (B:)
    krahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhthqq
    diddlkrqnalleqqv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nlwD (D:)
    srsthnemeknrrahlrlsleklkglvplgpdssrhttlslltkaklhikkledsdrkav
    hqidqlqreqrhlkrqlekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nlwD (D:)
    srsthnemeknrrahlrlsleklkglvplgpdssrhttlslltkaklhikkledsdrkav
    hqidqlqreqrhlkrql
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1nlwE (E:)
    krahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhthqq
    diddlkrqnalleqqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nlwE (E:)
    ahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhthqqdi
    ddlkrqnalleqqv