PDB entry 1nlt

View 1nlt on RCSB PDB site
Description: The crystal structure of Hsp40 Ydj1
Class: protein transport
Keywords: beta-strands, chaperone, heat shock, mitochondrion, PROTEIN TRANSPORT
Deposited on 2003-01-07, released 2004-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.269
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitochondrial protein import protein MAS5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: MAS5 OR YDJ1 OR YNL064C OR N2418 OR YNL2418C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25491
      • engineered (232)
    Domains in SCOPe 2.07: d1nlta1, d1nlta2, d1nlta3
  • Chain 'B':
    Compound: Seven residue peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1NLT (0-6)
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nltA (A:)
    gaqrprgpqrgkdikheisasleelykgrtaklalnkqilckecegrggkkgavkkctsc
    ngqgikfvtrqmgpmiqrfqtecdvchgtgdiidpkdrckscngkkvenerkilevhvep
    gmkdgqrivfkgeadqapdvipgdvvfivserphksfkrdgddlvyeaeidlltaiagge
    falehvsgdwlkvgivpgeviapgmrkviegkgmpipkyggygnliikftikdpenhfts
    eenlkkle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nltA (A:)
    pqrgkdikheisasleelykgrtaklalnkqilckecegrggkkgavkkctscngqgikf
    vtrqmgpmiqrfqtecdvchgtgdiidpkdrckscngkkvenerkilevhvepgmkdgqr
    ivfkgeadqapdvipgdvvfivserphksfkrdgddlvyeaeidlltaiaggefalehvs
    gdwlkvgivpgeviapgmrkviegkgmpipkyggygnliikftikdpe
    

  • Chain 'B':
    No sequence available.