PDB entry 1nlp

View 1nlp on RCSB PDB site
Description: structure of signal transduction protein, nmr, minimized average structure
Class: complex (transferase/peptide)
Keywords: src, sh3 domain, ligands, non-peptide elements, complex (transferase/peptide)
Deposited on 1996-08-04, released 1997-01-27
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: c-src
    Species: Gallus gallus [TaxId:9031]
    Gene: CHICKEN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1nlpc_
  • Chain 'N':
    Compound: nl2 (mn8-mn1-plpplp)
    Database cross-references and differences (RAF-indexed):
    • PDB 1NLP

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >1nlpC (C:)
gshmggvttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsny
vaps

    Sequence, based on observed residues (ATOM records): (download) 
    >1nlpC (C:)
tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps

  • Chain 'N':
    No sequence available.