PDB entry 1nlo

View 1nlo on RCSB PDB site
Description: structure of signal transduction protein, nmr, minimized average structure
Deposited on 1996-08-04, released 1997-01-27
The last revision prior to the SCOP 1.57 freeze date was dated 1997-01-27, with a file datestamp of 1997-01-27.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Domains in SCOP 1.57: d1nloc_

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nloC (C:)
    tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps