PDB entry 1nln

View 1nln on RCSB PDB site
Description: crystal structure of human adenovirus 2 proteinase with its 11 amino acid cofactor at 1.6 angstrom resolution
Class: hydrolase
Keywords: thiol hydrolase, viral proteinase, peptide cofactor
Deposited on 2003-01-07, released 2003-08-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.136
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenain
    Species: Human adenovirus C [TaxId:10515]
    Gene: L3-23k
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nlna_
  • Chain 'B':
    Compound: pvic
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1NLN (0-10)
  • Heterogens: ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nlnA (A:)
    mgsseqelkaivkdlgcgpyflgtydkrfpgfvsphklacaivntagretggvhwmafaw
    nprsktcylfepfgfsdqrlkqvyqfeyesllrrsaiasspdrcitlekstqsvqgpnsa
    acglfccmflhafanwpqtpmdhnptmnlitgvpnsmlnspqvqptlrrnqeqlysfler
    hspyfrshsaqirsatsfchlknm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nlnA (A:)
    gsseqelkaivkdlgcgpyflgtydkrfpgfvsphklacaivntagretggvhwmafawn
    prsktcylfepfgfsdqrlkqvyqfeyesllrrsaiasspdrcitlekstqsvqgpnsaa
    cglfccmflhafanwpqtpmdhnptmnlitgvpnsmlnspqvqptlrrnqeqlysflerh
    spyfrshsaqirsatsfchlknm
    

  • Chain 'B':
    No sequence available.