PDB entry 1nli

View 1nli on RCSB PDB site
Description: Complex of [E160A-E189A] trichosanthin and adenine
Class: hydrolase
Keywords: protein-DNA complex, ribosome-inactivating protein, HYDROLASE
Deposited on 2003-01-07, released 2003-01-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.16
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosome-inactivating protein alpha-trichosanthin
    Species: Trichosanthes kirilowii [TaxId:3677]
    Gene: Trichosanthin
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09989 (1-247)
      • cloning artifact (0)
      • engineered (160)
      • engineered (189)
    Domains in SCOPe 2.03: d1nlia_
  • Heterogens: ADE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1nliA (A:)
mdvsfrlsgatsssygvfisnlrkalpnerklydipllrsslpgsqryalihltnyadet
isvaidvtnvyimgyragdtsyffneasateaakyvfkdamrkvtlpysgnyerlqtaag
kireniplglpaldsaittlfyynansaasalmvliqstsaaarykfieqqigkrvdktf
lpslaiislanswsalskqiqiastnngqfespvvlinaqnqrvtitnvdagvvtsnial
llnrnnma