PDB entry 1nld

View 1nld on RCSB PDB site
Description: fab fragment of a neutralizing antibody directed against an epitope of gp41 from hiv-1
Class: immunoglobulin
Keywords: fab fragment, immunoglobulin
Deposited on 1996-07-02, released 1996-12-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.198
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: fab1583
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1NLD (0-214)
    Domains in SCOPe 2.05: d1nldh1, d1nldh2
  • Chain 'L':
    Compound: fab1583
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR PC4203 (0-218)
      • conflict (2)
      • conflict (9)
      • conflict (11)
      • conflict (13-14)
      • conflict (16-17)
      • conflict (23)
      • conflict (26)
      • conflict (26)
      • conflict (26)
      • conflict (32)
      • conflict (34)
      • conflict (38)
      • conflict (40)
      • conflict (43)
      • conflict (50)
      • conflict (54)
      • conflict (57-59)
      • conflict (67)
      • conflict (93)
      • conflict (96)
      • conflict (98)
    Domains in SCOPe 2.05: d1nldl1, d1nldl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nldH (H:)
    qvklqqsgpglvqpsqslsitctvsgfsltcygvhwvrqspgkglewlgviwsggdtdyn
    aafisrlsitkdnsksqvffkmnslqpndraiyycarrggdfwgqgttvtvssasttaps
    vyplapvsgdqtnssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsss
    vtvtsspwpsetitcnvahpasstkvdkkieprgc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nldL (L:)
    dvvmtqtpltlsvtigqpasisckssqslldsdgktylnwllqrpgqspkrliylvskld
    sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgthfprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec