PDB entry 1nl4

View 1nl4 on RCSB PDB site
Description: Crystal Structure of Rat Farnesyl Transferase in Complex With A Potent Biphenyl Inhibitor
Class: transferase
Keywords: Transferase, Prenyltransferase
Deposited on 2003-01-06, released 2003-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein farnesyltransferase alpha subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fnta
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04631 (0-311)
      • see remark 999 (101)
    Domains in SCOPe 2.07: d1nl4a_
  • Chain 'B':
    Compound: Protein farnesyltransferase beta subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fntb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nl4b_
  • Heterogens: ZN, HFP, FTL

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nl4A (A:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyitaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqsk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nl4B (B:)
    lyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfhyl
    krglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggfgg
    gpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevdvr
    saycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvil
    kkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdpa
    lsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgaml
    hdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf