PDB entry 1nl3

View 1nl3 on RCSB PDB site
Description: CRYSTAL STRUCTURE OF THE SECA PROTEIN TRANSLOCATION ATPASE FROM MYCOBACTERIUM TUBERCULOSIS in APO FORM
Class: protein transport
Keywords: PREPROTEIN TRANSLOCATION, ATPASE, TRANSMEMBRANE TRANSPORT, HELICASE-LIKE MOTOR DOMAIN, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, PROTEIN TRANSPORT
Deposited on 2003-01-06, released 2003-03-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.196
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Preprotein translocase secA 1 subunit
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: SECA1 OR SECA OR RV3240C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A5Y8 (31-End)
      • cloning artifact (14-30)
    Domains in SCOPe 2.07: d1nl3a1, d1nl3a2, d1nl3a3, d1nl3a4, d1nl3a5
  • Chain 'B':
    Compound: Preprotein translocase secA 1 subunit
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: SECA1 OR SECA OR RV3240C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A5Y8 (31-End)
      • cloning artifact (14-30)
    Domains in SCOPe 2.07: d1nl3b1, d1nl3b2, d1nl3b3, d1nl3b4, d1nl3b5
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nl3A (A:)
    mketaaakferqhmdspdlgtlvprgsmadilskllrlgegrmvkrlkkvadyvgtlsdd
    vekltdaelraktdefkrrladqknpetlddllpeafavareaawrvldqrpfdvqvmga
    aalhlgnvaemktgegktltcvlpaylnalagngvhivtvndylakrdsewmgrvhrflg
    lqvgvilatmtpderrvaynaditygtnnefgfdylrdnmahslddlvqrghhyaivdev
    dsilideartpliisgpadgasnwytefarlaplmekdvhyevdlrkrtvgvhekgvefv
    edqlgidnlyeaansplvsylnnalkakelfsrdkdyivrdgevlivdeftgrvligrry
    negmhqaieakehveikaenqtlatitlqnyfrlydklagmtgtaqteaaelheiyklgv
    vsiptnmpmiredqsdliykteeakyiavvddvaeryakgqpvligttsverseylsrqf
    tkrriphnvlnakyheqeatiiavagrrggvtvatnmagrgtdivlggnvdfltdqrlre
    rgldpvetpeeyeaawhselpivkeeaskeakevieagglyvlgterhesrridnqlrgr
    sgrqgdpgesrfylslgdelmrrfngaaletlltrlnlpddvpieakmvtraiksaqtqv
    eqqnfevrknvlkydevmnqqrkviyaerrrilegenlkdqaldmvrdvitayvdgatge
    gyaedwdldalwtalktlypvgitadsltrkdheferddltreelleallkdaerayaar
    eaeleeiagegamrqlernvllnvidrkwrehlyemdylkegiglramaqrdplveyqre
    gydmfmamldgmkeesvgflfnvtveavpappvapaaepaelaefaaaaaaaaqqrsavd
    ggarerapsalrakgvasespa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nl3A (A:)
    dspdlgtlvprgsmadilskllrlgegrmvkrlkkvadyvgtlsddvekltdaelraktd
    efkrrladqknpetlddllpeafavareaawrvldqrpfdvqvmgaaalhlgnvaemktg
    egktltcvlpaylnalagngvhivtvndylakrdsewmgrvhrflglqvgvilatmtpde
    rrvaynaditygtnnefgfdylrdnmahslddlvqrghhyaivdevdsilideartplii
    sgpadgasnwytefarlaplmekdvhyevdlrkrtvgvhekgvefvedqlgidnlyeaan
    splvsylnnalkakelfsrdkdyivrdgevlivdeftgrvligrrynegmhqaieakehv
    eikaenqtlatitlqnyfrlydklagmtgtaqteaaelheiyklgvvsiptnmpmiredq
    sdliykteeakyiavvddvaeryakgqpvligttsverseylsrqftkrriphnvlnaky
    heqeatiiavagrrggvtvatnmagrgtdivlggnvdfltdqrlrergldpvetpeeyea
    awhselpivkeeaskeakevieagglyvlgterhesrridnqlrgrsgrqgdpgesrfyl
    slgdelmrrfngaaletlltrlnlpddvpieakmvtraiksaqtqveqqnfevrknvlky
    devmnqqrkviyaerrrilegenlkdqaldmvrdvitayvdgatgegyaedwdldalwta
    lktlypvgitadsltreelleallkdaerayaareaeleeiagegamrqlernvllnvid
    rkwrehlyemdylkegiglramaqrdplveyqregydmfmamldgmkeesvgflfnvtv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nl3B (B:)
    mketaaakferqhmdspdlgtlvprgsmadilskllrlgegrmvkrlkkvadyvgtlsdd
    vekltdaelraktdefkrrladqknpetlddllpeafavareaawrvldqrpfdvqvmga
    aalhlgnvaemktgegktltcvlpaylnalagngvhivtvndylakrdsewmgrvhrflg
    lqvgvilatmtpderrvaynaditygtnnefgfdylrdnmahslddlvqrghhyaivdev
    dsilideartpliisgpadgasnwytefarlaplmekdvhyevdlrkrtvgvhekgvefv
    edqlgidnlyeaansplvsylnnalkakelfsrdkdyivrdgevlivdeftgrvligrry
    negmhqaieakehveikaenqtlatitlqnyfrlydklagmtgtaqteaaelheiyklgv
    vsiptnmpmiredqsdliykteeakyiavvddvaeryakgqpvligttsverseylsrqf
    tkrriphnvlnakyheqeatiiavagrrggvtvatnmagrgtdivlggnvdfltdqrlre
    rgldpvetpeeyeaawhselpivkeeaskeakevieagglyvlgterhesrridnqlrgr
    sgrqgdpgesrfylslgdelmrrfngaaletlltrlnlpddvpieakmvtraiksaqtqv
    eqqnfevrknvlkydevmnqqrkviyaerrrilegenlkdqaldmvrdvitayvdgatge
    gyaedwdldalwtalktlypvgitadsltrkdheferddltreelleallkdaerayaar
    eaeleeiagegamrqlernvllnvidrkwrehlyemdylkegiglramaqrdplveyqre
    gydmfmamldgmkeesvgflfnvtveavpappvapaaepaelaefaaaaaaaaqqrsavd
    ggarerapsalrakgvasespa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nl3B (B:)
    dspdlgtlvprgsmadilskllrlgegrmvkrlkkvadyvgtlsddvekltdaelraktd
    efkrrladqknpetlddllpeafavareaawrvldqrpfdvqvmgaaalhlgnvaemktg
    egktltcvlpaylnalagngvhivtvndylakrdsewmgrvhrflglqvgvilatmtpde
    rrvaynaditygtnnefgfdylrdnmahslddlvqrghhyaivdevdsilideartplii
    sgpadgasnwytefarlaplmekdvhyevdlrkrtvgvhekgvefvedqlgidnlyeaan
    splvsylnnalkakelfsrdkdyivrdgevlivdeftgrvligrrynegmhqaieakehv
    eikaenqtlatitlqnyfrlydklagmtgtaqteaaelheiyklgvvsiptnmpmiredq
    sdliykteeakyiavvddvaeryakgqpvligttsverseylsrqftkrriphnvlnaky
    heqeatiiavagrrggvtvatnmagrgtdivlggnvdfltdqrlrergldpvetpeeyea
    awhselpivkeeaskeakevieagglyvlgterhesrridnqlrgrsgrqgdpgesrfyl
    slgdelmrrfngaaletlltrlnlpddvpieakmvtraiksaqtqveqqnfevrknvlky
    devmnqqrkviyaerrrilegenlkdqaldmvrdvitayvdgatgegyaedwdldalwta
    lktlypvgitadslteelleallkdaerayaareaeleeiagegamrqlernvllnvidr
    kwrehlyemdylkegiglramaqrdplveyqregydmfmamldgmkeesvgflfnvtv