PDB entry 1nl1

View 1nl1 on RCSB PDB site
Description: bovine prothrombin fragment 1 in complex with calcium ion
Deposited on 2003-01-06, released 2003-09-16
The last revision prior to the SCOP 1.67 freeze date was dated 2003-09-16, with a file datestamp of 2003-09-16.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.219
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1nl1A (A:)
ankgfleevrkgnlerecleepcsreeafealeslsatdafwakytacesarnpreklne
clegncaegvgmnyrgnvsvtrsgiecqlwrsryphkpeinstthpgadlrenfcrnpdg
sitgpwcyttsptlrreecsvpvcgqd