PDB entry 1nl0

View 1nl0 on RCSB PDB site
Description: Crystal structure of human factor IX Gla domain in complex of an inhibitory antibody, 10C12
Class: immune system
Keywords: immune system, antibody, gla domain
Deposited on 2003-01-06, released 2004-01-20
The last revision prior to the SCOP 1.73 freeze date was dated 2004-04-13, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.233
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: factor ix
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00740 (0-44)
      • modified residue (6-7)
      • modified residue (14)
      • modified residue (16)
      • modified residue (19-20)
      • modified residue (25-26)
      • modified residue (29)
      • modified residue (32)
      • modified residue (35)
      • modified residue (39)
    Domains in SCOP 1.73: d1nl0g_
  • Chain 'H':
    Compound: anti-factor IX antibody, 10C12, chain H
    Species: HOMO SAPIENS
    Gene: 10C12
    Domains in SCOP 1.73: d1nl0h1, d1nl0h2
  • Chain 'L':
    Compound: anti-factor IX antibody, 10C12, chain L
    Species: HOMO SAPIENS
    Gene: 10C12
    Domains in SCOP 1.73: d1nl0l1, d1nl0l2
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1nl0G (G:)
    ynsgkleefvqgnlerecmeekcsfeearevfenterttefwkqyeeeeee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nl0G (G:)
    ynsgkleefvqgnlerecmeekcsfeearevfenterttefwkqy
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1nl0H (H:)
    gvqlvesgggvvqpgrslrlscaasgftfstyamhwvrqapgkglewvaiisydgskkyy
    adsvkgrftisrdnskntlylqmnslraedtavyycarasiaaarvldywgrgtmvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nl0H (H:)
    gvqlvesgggvvqpgrslrlscaasgftfstyamhwvrqapgkglewvaiisydgskkyy
    adsvkgrftisrdnskntlylqmnslraedtavyycarasiaaarvldywgrgtmvtvss
    astkgpsvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
    vtvpssslgtqtyicnvnhkpsntkvdkkvepkscd
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nl0L (L:)
    qsvltqppsvsaapgqkvtiscsgstsnignnyvswyqqhpgkapklmiydvskrpsgvp
    drfsgsksgnsasldisglqsedeadyycaawddslseflfgtgtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshksyscqvthegstvektvapt