PDB entry 1nkv

View 1nkv on RCSB PDB site
Description: x-ray structure of yjhp from e.coli northeast structural genomics research consortium (nesg) target er13
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2003-01-03, released 2003-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.22
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HYPOTHETICAL PROTEIN yjhP
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39367 (Start-247)
      • modified residue (33)
      • modified residue (49)
      • modified residue (66)
      • modified residue (135)
      • modified residue (183)
      • modified residue (202)
    Domains in SCOPe 2.07: d1nkva_
  • Chain 'B':
    Compound: HYPOTHETICAL PROTEIN yjhP
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39367 (Start-247)
      • modified residue (33)
      • modified residue (49)
      • modified residue (66)
      • modified residue (135)
      • modified residue (183)
      • modified residue (202)
      • expression tag (248)
    Domains in SCOPe 2.07: d1nkvb1, d1nkvb2
  • Chain 'C':
    Compound: HYPOTHETICAL PROTEIN yjhP
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39367 (0-247)
      • modified residue (0)
      • modified residue (33)
      • modified residue (49)
      • modified residue (66)
      • modified residue (135)
      • modified residue (183)
      • modified residue (202)
      • expression tag (248-252)
    Domains in SCOPe 2.07: d1nkvc1, d1nkvc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nkvA (A:)
    mdipriftisesehrihnpfteekyatlgrvlrmkpgtrildlgsgsgemlctwardhgi
    tgtgidmsslftaqakrraeelgvservhfihndaagyvanekcdvaacvgatwiaggfa
    gaeellaqslkpggimligepywrqlpateeiaqacgvsstsdfltlpglvgafddlgyd
    vvemvladqegwdryeaakwltmrrwleanpdddfaaevraelniapkryvtyarecfgw
    gvfaliarlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nkvA (A:)
    priftisesehrihnpfteekyatlgrvlrmkpgtrildlgsgsgemlctwardhgitgt
    gidmsslftaqakrraeelgvservhfihndaagyvanekcdvaacvgatwiaggfagae
    ellaqslkpggimligepywrqlpateeiaqacgvsstsdfltlpglvgafddlgydvve
    mvladqegwdryeaakwltmrrwleanpdddfaaevraelniapkryvtyarecfgwgvf
    aliar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nkvB (B:)
    mdipriftisesehrihnpfteekyatlgrvlrmkpgtrildlgsgsgemlctwardhgi
    tgtgidmsslftaqakrraeelgvservhfihndaagyvanekcdvaacvgatwiaggfa
    gaeellaqslkpggimligepywrqlpateeiaqacgvsstsdfltlpglvgafddlgyd
    vvemvladqegwdryeaakwltmrrwleanpdddfaaevraelniapkryvtyarecfgw
    gvfaliarlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nkvB (B:)
    ipriftisesehrihnpfteekyatlgrvlrmkpgtrildlgsgsgemlctwardhgitg
    tgidmlftaqakrraeelgvservhfiyvanekcdvaacvgagaeellaqslkpggimli
    gepywrqlpateeiaqacgvsstsdfltlpglvgafddlgydvvemvladqegwdryeaa
    kwltmrrwleanpdddfaaevraelniapkryvtyarecfgwgvfaliarl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nkvC (C:)
    mdipriftisesehrihnpfteekyatlgrvlrmkpgtrildlgsgsgemlctwardhgi
    tgtgidmsslftaqakrraeelgvservhfihndaagyvanekcdvaacvgatwiaggfa
    gaeellaqslkpggimligepywrqlpateeiaqacgvsstsdfltlpglvgafddlgyd
    vvemvladqegwdryeaakwltmrrwleanpdddfaaevraelniapkryvtyarecfgw
    gvfaliarlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nkvC (C:)
    mdipriftisesehrihnpfteekyatlgrvlrmkpgtrildlgsgsgemlctwardhgi
    tgtgidmsslftaqakrraeelgvservhfihndaagyvanekcdvaacvgatwiaggee
    llaqslkpggimligepywrqlpateeiaqacgvsstsdfltlpglvgafddlgydvvem
    vladqegwdryeaakwltmrrwleanpdddfaaevraelniapkryvtyarecfgwgvfa
    liarlehhh