PDB entry 1nkt

View 1nkt on RCSB PDB site
Description: crystal structure of the seca protein translocation ATPase from mycobacterium tuberculosis complex with adpbs
Class: protein transport
Keywords: PREPROTEIN TRANSLOCATION, ATPASE, TRANSMEMBRANE TRANSPORT, HELICASE-LIKE MOTOR DOMAIN, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC
Deposited on 2003-01-03, released 2003-03-04
The last revision prior to the SCOP 1.73 freeze date was dated 2005-02-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.216
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Preprotein translocase secA 1 subunit
    Species: Mycobacterium tuberculosis
    Gene: SECA1 OR SECA OR RV3240C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A5Y8 (31-End)
      • cloning artifact (14-30)
    Domains in SCOP 1.73: d1nkta1, d1nkta2, d1nkta3, d1nkta4
  • Chain 'B':
    Compound: Preprotein translocase secA 1 subunit
    Species: Mycobacterium tuberculosis
    Gene: SECA1 OR SECA OR RV3240C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A5Y8 (31-End)
      • cloning artifact (14-30)
    Domains in SCOP 1.73: d1nktb1, d1nktb2, d1nktb3, d1nktb4
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nktA (A:)
    mketaaakferqhmdspdlgtlvprgsmadilskllrlgegrmvkrlkkvadyvgtlsdd
    vekltdaelraktdefkrrladqknpetlddllpeafavareaawrvldqrpfdvqvmga
    aalhlgnvaemktgegktltcvlpaylnalagngvhivtvndylakrdsewmgrvhrflg
    lqvgvilatmtpderrvaynaditygtnnefgfdylrdnmahslddlvqrghhyaivdev
    dsilideartpliisgpadgasnwytefarlaplmekdvhyevdlrkrtvgvhekgvefv
    edqlgidnlyeaansplvsylnnalkakelfsrdkdyivrdgevlivdeftgrvligrry
    negmhqaieakehveikaenqtlatitlqnyfrlydklagmtgtaqteaaelheiyklgv
    vsiptnmpmiredqsdliykteeakyiavvddvaeryakgqpvligttsverseylsrqf
    tkrriphnvlnakyheqeatiiavagrrggvtvatnmagrgtdivlggnvdfltdqrlre
    rgldpvetpeeyeaawhselpivkeeaskeakevieagglyvlgterhesrridnqlrgr
    sgrqgdpgesrfylslgdelmrrfngaaletlltrlnlpddvpieakmvtraiksaqtqv
    eqqnfevrknvlkydevmnqqrkviyaerrrilegenlkdqaldmvrdvitayvdgatge
    gyaedwdldalwtalktlypvgitadsltrkdheferddltreelleallkdaerayaar
    eaeleeiagegamrqlernvllnvidrkwrehlyemdylkegiglramaqrdplveyqre
    gydmfmamldgmkeesvgflfnvtveavpappvapaaepaelaefaaaaaaaaqqrsavd
    ggarerapsalrakgvasespa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nktA (A:)
    dspdlgtlvprgsmadilskllrlgegrmvkrlkkvadyvgtlsddvekltdaelraktd
    efkrrladqknpetlddllpeafavareaawrvldqrpfdvqvmgaaalhlgnvaemktg
    egktltcvlpaylnalagngvhivtvndylakrdsewmgrvhrflglqvgvilatmtpde
    rrvaynaditygtnnefgfdylrdnmahslddlvqrghhyaivdevdsilideartplii
    sgpadgasnwytefarlaplmekdvhyevdlrkrtvgvhekgvefvedqlgidnlyeaan
    splvsylnnalkakelfsrdkdyivrdgevlivdeftgrvligrrynegmhqaieakehv
    eikaenqtlatitlqnyfrlydklagmtgtaqteaaelheiyklgvvsiptnmpmiredq
    sdliykteeakyiavvddvaeryakgqpvligttsverseylsrqftkrriphnvlnaky
    heqeatiiavagrrggvtvatnmagrgtdivlggnvdfltdqrlrergldpvetpeeyea
    awhselpivkeeaskeakevieagglyvlgterhesrridnqlrgrsgrqgdpgesrfyl
    slgdelmrrfngaaletlltrlnlpddvpieakmvtraiksaqtqveqqnfevrknvlky
    devmnqqrkviyaerrrilegenlkdqaldmvrdvitayvdgatgegyaedwdldalwta
    lktlypvgitadsltlleallkdaerayaareaeleeiagegamrqlernvllnvidrkw
    rehlyemdylkegiglramaqrdplveyqregydmfmamldgmkeesvgflfnvtv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nktB (B:)
    mketaaakferqhmdspdlgtlvprgsmadilskllrlgegrmvkrlkkvadyvgtlsdd
    vekltdaelraktdefkrrladqknpetlddllpeafavareaawrvldqrpfdvqvmga
    aalhlgnvaemktgegktltcvlpaylnalagngvhivtvndylakrdsewmgrvhrflg
    lqvgvilatmtpderrvaynaditygtnnefgfdylrdnmahslddlvqrghhyaivdev
    dsilideartpliisgpadgasnwytefarlaplmekdvhyevdlrkrtvgvhekgvefv
    edqlgidnlyeaansplvsylnnalkakelfsrdkdyivrdgevlivdeftgrvligrry
    negmhqaieakehveikaenqtlatitlqnyfrlydklagmtgtaqteaaelheiyklgv
    vsiptnmpmiredqsdliykteeakyiavvddvaeryakgqpvligttsverseylsrqf
    tkrriphnvlnakyheqeatiiavagrrggvtvatnmagrgtdivlggnvdfltdqrlre
    rgldpvetpeeyeaawhselpivkeeaskeakevieagglyvlgterhesrridnqlrgr
    sgrqgdpgesrfylslgdelmrrfngaaletlltrlnlpddvpieakmvtraiksaqtqv
    eqqnfevrknvlkydevmnqqrkviyaerrrilegenlkdqaldmvrdvitayvdgatge
    gyaedwdldalwtalktlypvgitadsltrkdheferddltreelleallkdaerayaar
    eaeleeiagegamrqlernvllnvidrkwrehlyemdylkegiglramaqrdplveyqre
    gydmfmamldgmkeesvgflfnvtveavpappvapaaepaelaefaaaaaaaaqqrsavd
    ggarerapsalrakgvasespa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nktB (B:)
    dspdlgtlvprgsmadilskllrlgegrmvkrlkkvadyvgtlsddvekltdaelraktd
    efkrrladqknpetlddllpeafavareaawrvldqrpfdvqvmgaaalhlgnvaemktg
    egktltcvlpaylnalagngvhivtvndylakrdsewmgrvhrflglqvgvilatmtpde
    rrvaynaditygtnnefgfdylrdnmahslddlvqrghhyaivdevdsilideartplii
    sgpadgasnwytefarlaplmekdvhyevdlrkrtvgvhekgvefvedqlgidnlyeaan
    splvsylnnalkakelfsrdkdyivrdgevlivdeftgrvligrrynegmhqaieakehv
    eikaenqtlatitlqnyfrlydklagmtgtaqteaaelheiyklgvvsiptnmpmiredq
    sdliykteeakyiavvddvaeryakgqpvligttsverseylsrqftkrriphnvlnaky
    heqeatiiavagrrggvtvatnmagrgtdivlggnvdfltdqrlrergldpvetpeeyea
    awhselpivkeeaskeakevieagglyvlgterhesrridnqlrgrsgrqgdpgesrfyl
    slgdelmrrfngaaletlltrlnlpddvpieakmvtraiksaqtqveqqnfevrknvlky
    devmnqqrkviyaerrrilegenlkdqaldmvrdvitayvdgatgegyaedwdldalwta
    lktlypvgitadsltlleallkdaerayaareaeleeiagegamrqlernvllnvidrkw
    rehlyemdylkegiglramaqrdplveyqregydmfmamldgmkeesvgflfnvtv