PDB entry 1nks

View 1nks on RCSB PDB site
Description: adenylate kinase from sulfolobus acidocaldarius
Deposited on 1998-07-16, released 1998-12-09
The last revision prior to the SCOP 1.61 freeze date was dated 1999-01-13, with a file datestamp of 1999-01-20.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: 0.164
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1nksa_
  • Chain 'B':
    Domains in SCOP 1.61: d1nksb_
  • Chain 'C':
    Domains in SCOP 1.61: d1nksc_
  • Chain 'D':
    Domains in SCOP 1.61: d1nksd_
  • Chain 'E':
    Domains in SCOP 1.61: d1nkse_
  • Chain 'F':
    Domains in SCOP 1.61: d1nksf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nksA (A:)
    mkigivtgipgvgkstvlakvkeildnqginnkiinygdfmlatalklgyakdrdemrkl
    svekqkklqidaakgiaeearaggegylfidthavirtpsgylpglpsyviteinpsvif
    lleadpkiilsrqkrdttrnrndysdesviletinfaryaatasavlagstvkvivnveg
    dpsiaaneiirsmk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nksB (B:)
    mkigivtgipgvgkstvlakvkeildnqginnkiinygdfmlatalklgyakdrdemrkl
    svekqkklqidaakgiaeearaggegylfidthavirtpsgylpglpsyviteinpsvif
    lleadpkiilsrqkrdttrnrndysdesviletinfaryaatasavlagstvkvivnveg
    dpsiaaneiirsmk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nksC (C:)
    mkigivtgipgvgkstvlakvkeildnqginnkiinygdfmlatalklgyakdrdemrkl
    svekqkklqidaakgiaeearaggegylfidthavirtpsgylpglpsyviteinpsvif
    lleadpkiilsrqkrdttrnrndysdesviletinfaryaatasavlagstvkvivnveg
    dpsiaaneiirsmk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nksD (D:)
    mkigivtgipgvgkstvlakvkeildnqginnkiinygdfmlatalklgyakdrdemrkl
    svekqkklqidaakgiaeearaggegylfidthavirtpsgylpglpsyviteinpsvif
    lleadpkiilsrqkrdttrnrndysdesviletinfaryaatasavlagstvkvivnveg
    dpsiaaneiirsmk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nksE (E:)
    mkigivtgipgvgkstvlakvkeildnqginnkiinygdfmlatalklgyakdrdemrkl
    svekqkklqidaakgiaeearaggegylfidthavirtpsgylpglpsyviteinpsvif
    lleadpkiilsrqkrdttrnrndysdesviletinfaryaatasavlagstvkvivnveg
    dpsiaaneiirsmk
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nksF (F:)
    mkigivtgipgvgkstvlakvkeildnqginnkiinygdfmlatalklgyakdrdemrkl
    svekqkklqidaakgiaeearaggegylfidthavirtpsgylpglpsyviteinpsvif
    lleadpkiilsrqkrdttrnrndysdesviletinfaryaatasavlagstvkvivnveg
    dpsiaaneiirsmk