PDB entry 1nkp

View 1nkp on RCSB PDB site
Description: Crystal structure of Myc-Max recognizing DNA
Class: transcription/DNA
Keywords: TRANSCRIPTION, DNA, bHLHZ, oncogene, heterodimer
Deposited on 2003-01-03, released 2003-02-04
The last revision prior to the SCOP 1.73 freeze date was dated 2003-02-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.219
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myc proto-oncogene protein
    Species: HOMO SAPIENS
    Gene: Myc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01106
      • cloning artifact (0-2)
      • insertion (85-87)
    Domains in SCOP 1.73: d1nkpa_
  • Chain 'B':
    Compound: max protein
    Species: HOMO SAPIENS
    Gene: Max
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61244
      • insertion (80-82)
    Domains in SCOP 1.73: d1nkpb_
  • Chain 'D':
    Compound: myc proto-oncogene protein
    Species: HOMO SAPIENS
    Gene: Myc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01106 (3-84)
      • cloning artifact (2)
    Domains in SCOP 1.73: d1nkpd_
  • Chain 'E':
    Compound: max protein
    Species: HOMO SAPIENS
    Gene: Max
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61244 (Start-79)
      • insertion (80-82)
    Domains in SCOP 1.73: d1nkpe_
  • Chain 'F':
    Compound: 5'-d(*cp*gp*ap*gp*tp*ap*gp*cp*ap*cp*gp*tp*gp*cp*tp*ap*cp*tp*c)-3'
  • Chain 'G':
    Compound: 5'-d(*cp*gp*ap*gp*tp*ap*gp*cp*ap*cp*gp*tp*gp*cp*tp*ap*cp*tp*c)-3'
  • Chain 'H':
    Compound: 5'-d(*cp*gp*ap*gp*tp*ap*gp*cp*ap*cp*gp*tp*gp*cp*tp*ap*cp*tp*c)-3'
  • Chain 'J':
    Compound: 5'-d(*cp*gp*ap*gp*tp*ap*gp*cp*ap*cp*gp*tp*gp*cp*tp*ap*cp*tp*c)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkpA (A:)
    ghmnvkrrthnvlerqrrnelkrsffalrdqipelennekapkvvilkkatayilsvqae
    eqkliseedllrkrreqlkhkleqlggc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkpB (B:)
    dkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhthq
    qdiddlkrqnalleqqvralggc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nkpD (D:)
    ghmnvkrrthnvlerqrrnelkrsffalrdqipelennekapkvvilkkatayilsvqae
    eqkliseedllrkrreqlkhkleqlggc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nkpD (D:)
    mnvkrrthnvlerqrrnelkrsffalrdqipelennekapkvvilkkatayilsvqaeeq
    kliseedllrkrreqlkhkleql
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1nkpE (E:)
    dkrahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhthq
    qdiddlkrqnalleqqvralggc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nkpE (E:)
    rahhnalerkrrdhikdsfhslrdsvpslqgekasraqildkateyiqymrrknhthqqd
    iddlkrqnalleqqvralggc
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'J':
    No sequence available.