PDB entry 1nko

View 1nko on RCSB PDB site
Description: Energetic and structural basis of sialylated oligosaccharide recognition by the natural killer cell inhibitory receptor p75/AIRM1 or Siglec-7
Class: immune system
Keywords: Immunoglobulin, Siglec7, IMMUNE SYSTEM
Deposited on 2003-01-03, released 2003-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.277
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sialic acid binding Ig-like lectin 7
    Species: Homo sapiens [TaxId:9606]
    Gene: SIGLEC7 OR AIRM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y286
      • engineered (36)
    Domains in SCOPe 2.07: d1nkoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nkoA (A:)
    qksnrkdysltmqssvtvqegmcvhvrcsfsypvdsdtdsdpvhgywfragndiswkapv
    atnnpawavqeetrdrfhllgdpqtknctlsirdarmsdagryffrmekgnikwnykydq
    lsvnvtalthrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nkoA (A:)
    snrkdysltmqssvtvqegmcvhvrcsfsypvdsdtdsdpvhgywfrawkapvatnnpaw
    avqeetrdrfhllgdpqtknctlsirdarmsdagryffrmekgnikwnykydqlsvnvta
    lt