PDB entry 1nki

View 1nki on RCSB PDB site
Description: crystal structure of the fosfomycin resistance protein a (fosa) containing bound phosphonoformate
Deposited on 2003-01-03, released 2004-01-13
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-13, with a file datestamp of 2004-01-13.
Experiment type: XRAY
Resolution: 0.95 Å
R-factor: 0.148
AEROSPACI score: 1.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1nkia_
  • Chain 'B':
    Domains in SCOP 1.67: d1nkib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nkiA (A:)
    mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa
    dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl
    aacrqapyagmrfad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nkiA (A:)
    mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa
    dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl
    aacrqapyagmrfa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nkiB (B:)
    mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa
    dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl
    aacrqapyagmrfad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nkiB (B:)
    mltglnhltlavadlpasiafyrdllgfrlearwdqgaylelgslwlclsrepqyggpaa
    dythyafgiaaadfarfaaqlrahgvrewkqnrsegdsfyfldpdghrleahvgdlrsrl
    aacrqapyagmrfa