PDB entry 1nkg

View 1nkg on RCSB PDB site
Description: rhamnogalacturonan lyase from aspergillus aculeatus
Deposited on 2003-01-03, released 2004-05-25
The last revision prior to the SCOP 1.69 freeze date was dated 2004-05-25, with a file datestamp of 2004-05-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.164
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkgA (A:)
    afgittsssayvidtnapnqlkftvsrsscditsiihygtelqyssqgshigsglgsatv
    tatqsgdyikvtcvtdtltqymvvhngdpiihmatyitaepsigelrfiarlnsdllpne
    epfgdvsttadgtaiegsdvflvgsetrskfysserfiddqrhciagdahrvcmilnqye
    sssggpfhrdinsnnggsynalywymnsghvqtesyrmglhgpysmyfsrsgtpstsidt
    sffadldikgyvaasgrgkvagtasgadssmdwvvhwyndaaqywtytsssgsftspamk
    pgtytmvyyqgeyavatssvtvsagstttknisgsvktgttifkigewdgqptgfrnaan
    qlrmhpsdsrmsswgpltytvgssaltdfpmavfksvnnpvtikftatsaqtgaatlrig
    ttlsfaggrpqatinsytgsapaaptnldsrgvtrgayrglgevydvsipsgtivagtnt
    itinvisgssgdtylspnfifdcvelfq