PDB entry 1nkg

View 1nkg on RCSB PDB site
Description: Rhamnogalacturonan lyase from Aspergillus aculeatus
Class: lyase
Keywords: polysaccharide lyase, carbohydrate active enzyme, pectin, LYASE
Deposited on 2003-01-03, released 2004-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.164
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rhamnogalacturonase B
    Species: Aspergillus aculeatus [TaxId:5053]
    Gene: RHGB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nkga1, d1nkga2, d1nkga3
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkgA (A:)
    afgittsssayvidtnapnqlkftvsrsscditsiihygtelqyssqgshigsglgsatv
    tatqsgdyikvtcvtdtltqymvvhngdpiihmatyitaepsigelrfiarlnsdllpne
    epfgdvsttadgtaiegsdvflvgsetrskfysserfiddqrhciagdahrvcmilnqye
    sssggpfhrdinsnnggsynalywymnsghvqtesyrmglhgpysmyfsrsgtpstsidt
    sffadldikgyvaasgrgkvagtasgadssmdwvvhwyndaaqywtytsssgsftspamk
    pgtytmvyyqgeyavatssvtvsagstttknisgsvktgttifkigewdgqptgfrnaan
    qlrmhpsdsrmsswgpltytvgssaltdfpmavfksvnnpvtikftatsaqtgaatlrig
    ttlsfaggrpqatinsytgsapaaptnldsrgvtrgayrglgevydvsipsgtivagtnt
    itinvisgssgdtylspnfifdcvelfq