PDB entry 1nkd

View 1nkd on RCSB PDB site
Description: atomic resolution (1.07 angstroms) structure of the rop mutant <2aa>
Class: transcription regulation
Keywords: rop (cole1 repressor of primer), atomic resolution structure, 4-alpha-helix bundle, transcription regulation
Deposited on 1997-09-23, released 1999-03-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.09 Å
R-factor: N/A
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rop
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03051 (0-End)
      • insertion (29)
      • insertion (31)
    Domains in SCOPe 2.08: d1nkda_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nkdA (A:)
    mtkqektalnmarfirsqtltlleklneladaadeqadiceslhdhadelyrsclarfgd
    dgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nkdA (A:)
    mtkqektalnmarfirsqtltlleklneladaadeqadiceslhdhadelyrsclarfg