PDB entry 1nk2

View 1nk2 on RCSB PDB site
Description: vnd/nk-2 homeodomain/DNA complex, nmr, 20 structures
Class: DNA binding protein/DNA
Keywords: homeodomain, homeobox, DNA-binding protein, embryonic development, complex (homeodomain/DNA), DNA binding protein/DNA complex
Deposited on 1998-05-06, released 1999-02-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (5'-d(*tp*gp*tp*gp*tp*cp*ap*ap*gp*tp*gp*gp*cp*tp*gp*t)-3')
  • Chain 'B':
    Compound: DNA (5'-d(*ap*cp*ap*gp*cp*cp*ap*cp*tp*tp*gp*ap*cp*ap*cp*a)-3')
  • Chain 'P':
    Compound: homeobox protein vnd
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22808 (0-76)
      • conflict (0)
    Domains in SCOPe 2.08: d1nk2p_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nk2P (P:)
    asdglpnkkrkrrvlftkaqtyelerrfrqqrylsaperehlaslirltptqvkiwfqnh
    ryktkraqnekgyeghp