PDB entry 1nk1

View 1nk1 on RCSB PDB site
Description: nk1 fragment of human hepatocyte growth factor/scatter factor (hgf/sf) at 2.5 angstrom resolution
Deposited on 1998-08-20, released 1999-01-13
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.245
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nk1A (A:)
    tihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkarkqcl
    wfpfnsmssgvkkefghefdlyenkdyirnciigkgrsykgtvsitksgikcqpwssmip
    hehsflpssyrgkdlqenycrnprgeeggpwcftsnpevryevcdipqcsev
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nk1B (B:)
    tihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkarkqcl
    wfpfnsmssgvkkefghefdlyenkdyirnciigkgrsykgtvsitksgikcqpwssmip
    hehsflpssyrgkdlqenycrnprgeeggpwcftsnpevryevcdipqcsev