PDB entry 1njs

View 1njs on RCSB PDB site
Description: human GAR Tfase in complex with hydrolyzed form of 10-trifluoroacetyl-5,10-dideaza-acyclic-5,6,7,8-tetrahydrofolic acid
Class: transferase
Keywords: protein-cofactor analogue complex, TRANSFERASE
Deposited on 2003-01-02, released 2003-06-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.228
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoribosylglycinamide formyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: GART
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1njsa_
  • Chain 'B':
    Compound: phosphoribosylglycinamide formyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: GART
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1njsb_
  • Heterogens: PO4, KEU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1njsA (A:)
    arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
    yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
    heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
    lqlvasgtvqlgengkicwvkeehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1njsA (A:)
    arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
    yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
    heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
    lqlvasgtvqlgengkicwv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1njsB (B:)
    arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
    yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
    heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
    lqlvasgtvqlgengkicwvkeehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1njsB (B:)
    arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
    yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
    heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
    lqlvasgtvqlgengkicwv