PDB entry 1njr

View 1njr on RCSB PDB site
Description: Crystal structure of yeast ymx7, an ADP-ribose-1''-monophosphatase
Class: structural genomics, unknown function
Keywords: Structural Genomics, Dimer, Two domain organization, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, UNKNOWN FUNCTION
Deposited on 2003-01-02, released 2004-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.206
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 32.1 kDa protein in ADH3-RCA1 intergenic region
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YMR087W or YM9582.12
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04299
      • modified residue (16)
      • modified residue (57)
      • modified residue (60)
      • modified residue (173)
      • modified residue (178)
      • modified residue (208)
      • modified residue (216)
      • modified residue (231)
      • modified residue (259)
    Domains in SCOPe 2.07: d1njra_
  • Heterogens: XYL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1njrA (A:)
    mtgslnrhsllngvkkmriilcdtnevvtnlwqesiphayiqndkylcihhghlqslmds
    mrkgdaihhghsyaivspgnsygylgggfdkalynyfggkpfetwfrnqlggryhtvgsa
    tvvdlqrcleektiecrdgiryiihvptvvapsapifnpqnplktgfepvfnamwnalmh
    spkdidgliipglctgyagvppiiscksmafalrlymagdhiskelknvlimyylqypfe
    pffpesckiecqklgidiemlksfnvekdaielliprriltldl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1njrA (A:)
    kmriilcdtnevvtnlwqesipkylcihhghlqslmdsmrkgdahsyaivspgnsygylg
    ggfdkalynyfggkpfetwfrnqlggryhtvgsatvvdlqrcleecrdgiryiihvptvv
    apsapifnpqnplktgfepvfnamwnalmhspkdidgliipglctgyagvppiiscksma
    falrlymagdhiskelknvlimyylqypfepffpesckiecqklgidiemlksfnvekda
    ielliprri