PDB entry 1njp

View 1njp on RCSB PDB site
Description: The crystal structure of the 50S Large ribosomal subunit from Deinococcus radiodurans complexed with a tRNA acceptor stem mimic (ASM)
Class: ribosome
Keywords: Ribosomes, tRNA, puromycin, sparsomycin, peptidyl-transferase, peptide bond formation
Deposited on 2003-01-02, released 2003-02-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.244
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: 23S ribosomal RNA
    Species: Deinococcus radiodurans [TaxId:1299]
  • Chain '5':
    Compound: tRNA acceptor stem mimic
    Species: synthetic, synthetic
  • Chain 'K':
    Compound: 50S ribosomal protein L16
    Species: Deinococcus radiodurans [TaxId:1299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1njpk_
  • Chain 'T':
    Compound: general stress protein ctc
    Species: Deinococcus radiodurans [TaxId:1299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1njpt_

PDB Chain Sequences:

  • Chain '0':
    No sequence available.

  • Chain '5':
    No sequence available.

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1njpK (K:)
    mllpkrtkfrkqfrgrmtgdakggdyvafgdygliamepawiksnqieacrivmsrhfrr
    ggkiyirifpdkpvtkkpaetrmgkgkgaveywvsvvkpgrvmfevagvteeqakeafrl
    aghklpiqtkmvkrevydeaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1njpK (K:)
    tkfrkqfrgrmtgdakggdyvafgdygliamepawiksnqieacrivmsrhfrrggkiyi
    rifpdkpvtkkpaetrmgkgkgaveywvsvvkpgrvmfevagvteeqakeafrlaghklp
    iqtk
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1njpT (T:)
    meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge
    tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl
    qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlpprltaee
    leaevqaaqvaglvaagelseeaaeavlegdasleevkaeasednagtdsednsdaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1njpT (T:)
    meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge
    tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl
    qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlpprltaee
    leaevqaaqvaglvaagelseeaaeavlegdasleevkaease