PDB entry 1njp

View 1njp on RCSB PDB site
Description: The crystal structure of the 50S Large ribosomal subunit from Deinococcus radiodurans complexed with a tRNA acceptor stem mimic (ASM)
Deposited on 2003-01-02, released 2003-02-11
The last revision prior to the SCOP 1.63 freeze date was dated 2003-02-11, with a file datestamp of 2003-02-11.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.244
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Domains in SCOP 1.63: d1njp0_
  • Chain 'K':
    Domains in SCOP 1.63: d1njpk_
  • Chain 'T':
    Domains in SCOP 1.63: d1njpt_

PDB Chain Sequences:

  • Chain '0':
    No sequence available.

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1njpK (K:)
    tkfrkqfrgrmtgdakggdyvafgdygliamepawiksnqieacrivmsrhfrrggkiyi
    rifpdkpvtkkpaetrmgkgkgaveywvsvvkpgrvmfevagvteeqakeafrlaghklp
    iqtk
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1njpT (T:)
    meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge
    tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl
    qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlpprltaee
    leaevqaaqvaglvaagelseeaaeavlegdasleevkaease