PDB entry 1njk

View 1njk on RCSB PDB site
Description: Crystal Structure of YbaW Probable Thioesterase from Escherichia coli
Deposited on 2002-12-31, released 2003-07-01
The last revision prior to the SCOP 1.67 freeze date was dated 2003-07-01, with a file datestamp of 2003-07-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.214
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1njka_
  • Chain 'B':
    Domains in SCOP 1.67: d1njkb_
  • Chain 'C':
    Domains in SCOP 1.67: d1njkc_
  • Chain 'D':
    Domains in SCOP 1.67: d1njkd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1njkA (A:)
    mgsshhhhhhssgrenlyfqghmqtqikvrgyhldvyqhvnnarylefleearwdglens
    dsfqwmtahniafvvvnininyrrpavlsdlltitsqlqqlngksgilsqvitlepegqv
    vadalitfvcidlktqkalalegelrekleqmvkgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1njkA (A:)
    hmqtqikvrgyhldvyqhvnnarylefleearwdglensdsfqwmtahniafvvvninin
    yrrpavlsdlltitsqlqqlngksgilsqvitlepegqvvadalitfvcidlktqkalal
    egelrekleqmvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1njkB (B:)
    mgsshhhhhhssgrenlyfqghmqtqikvrgyhldvyqhvnnarylefleearwdglens
    dsfqwmtahniafvvvnininyrrpavlsdlltitsqlqqlngksgilsqvitlepegqv
    vadalitfvcidlktqkalalegelrekleqmvkgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1njkB (B:)
    hmqtqikvrgyhldvyqhvnnarylefleearwdglensdsfqwmtahniafvvvninin
    yrrpavlsdlltitsqlqqlngksgilsqvitlepegqvvadalitfvcidlktqkalal
    egelrekleqmvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1njkC (C:)
    mgsshhhhhhssgrenlyfqghmqtqikvrgyhldvyqhvnnarylefleearwdglens
    dsfqwmtahniafvvvnininyrrpavlsdlltitsqlqqlngksgilsqvitlepegqv
    vadalitfvcidlktqkalalegelrekleqmvkgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1njkC (C:)
    hmqtqikvrgyhldvyqhvnnarylefleearwdglensdsfqwmtahniafvvvninin
    yrrpavlsdlltitsqlqqlngksgilsqvitlepegqvvadalitfvcidlktqkalal
    egelrekleqmvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1njkD (D:)
    mgsshhhhhhssgrenlyfqghmqtqikvrgyhldvyqhvnnarylefleearwdglens
    dsfqwmtahniafvvvnininyrrpavlsdlltitsqlqqlngksgilsqvitlepegqv
    vadalitfvcidlktqkalalegelrekleqmvkgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1njkD (D:)
    hmqtqikvrgyhldvyqhvnnarylefleearwdglensdsfqwmtahniafvvvninin
    yrrpavlsdlltitsqlqqlngksgilsqvitlepegqvvadalitfvcidlktqkalal
    egelrekleqmvk