PDB entry 1njj

View 1njj on RCSB PDB site
Description: crystal structure determination of t. brucei ornithine decarboxylase bound to d-ornithine and to g418
Deposited on 2002-12-31, released 2003-08-26
The last revision prior to the SCOP 1.67 freeze date was dated 2003-08-26, with a file datestamp of 2003-08-26.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.26
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1njjA (A:)
    ksmdivvnddlscrflegfntrdalckkismntcdegdpffvadlgdivrkhetwkkclp
    rvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigvppekiiyanpckqishi
    ryardsgvdvmtfdcvdelekvakthpkakmvlristddslarcrlsvkfgakvedcrfi
    leqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnmhildigggfpg
    trdaplkfeeiagvinnalekhfppdlkltivaepgryyvasaftlavnviakkvtpgvq
    tdvgahaesnaqsfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgptc
    dgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvvsglpdhvvrel
    ksqks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1njjA (A:)
    ntrdalckkgdpffvadlgdivrkhetwkkclprvtpfyavkcnddwrvlgtlaalgtgf
    dcasnteiqrvrgigvppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthp
    kakmvlristvkfgakvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrf
    vfdmgtelgfnmhildigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgr
    yyvasaftlavnviakkvtqsfmyyvndgvygsfncilydhavvrplpqrepeklypssv
    wgptcdgldqiveryylpemqvgewllfedmgaytvsptiyyvvsglpd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1njjB (B:)
    ksmdivvnddlscrflegfntrdalckkismntcdegdpffvadlgdivrkhetwkkclp
    rvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigvppekiiyanpckqishi
    ryardsgvdvmtfdcvdelekvakthpkakmvlristddslarcrlsvkfgakvedcrfi
    leqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnmhildigggfpg
    trdaplkfeeiagvinnalekhfppdlkltivaepgryyvasaftlavnviakkvtpgvq
    tdvgahaesnaqsfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgptc
    dgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvvsglpdhvvrel
    ksqks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1njjB (B:)
    ntrdalckkisgdpffvadlgdivrkhetwkkclprvtpfyavkcnddwrvlgtlaalgt
    gfdcasnteiqrvrgigvppekiiyanpckqishiryardsgvdvmtfdcvdelekvakt
    hpkakmvlristvkfgakvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisds
    rfvfdmgtelgfnmhildigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaep
    gryyvasaftlavnviakkvtqsfmyyvndgvygsfncilydhavvrplpqrepipnekl
    ypssvwgptcdgldqiveryylpemqvgewllfedmgaytvsptiyyvv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1njjC (C:)
    ksmdivvnddlscrflegfntrdalckkismntcdegdpffvadlgdivrkhetwkkclp
    rvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigvppekiiyanpckqishi
    ryardsgvdvmtfdcvdelekvakthpkakmvlristddslarcrlsvkfgakvedcrfi
    leqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnmhildigggfpg
    trdaplkfeeiagvinnalekhfppdlkltivaepgryyvasaftlavnviakkvtpgvq
    tdvgahaesnaqsfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgptc
    dgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvvsglpdhvvrel
    ksqks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1njjC (C:)
    rflegfntrdalckkgdpffvadlgdivrkhetwkkclprvtpfyavkcnddwrvlgtla
    algtgfdcasnteiqrvrgigvppekiiyanpckqishiryardsgvdvmtfdcvdelek
    vakthpkakmvlristvkfgakvedcrfileqakklnidvtgvsfhvgsgstdastfaqa
    isdsrfvfdmgtelgfnmhildigggfpgtrdaplkfeeiagvinnalekhfppdlklti
    vaepgryyvasaftlavnviakkvtqsfmyyvndgvygsfncilydhavvrplpqrepie
    klypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvsptiyyvv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1njjD (D:)
    ksmdivvnddlscrflegfntrdalckkismntcdegdpffvadlgdivrkhetwkkclp
    rvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigvppekiiyanpckqishi
    ryardsgvdvmtfdcvdelekvakthpkakmvlristddslarcrlsvkfgakvedcrfi
    leqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnmhildigggfpg
    trdaplkfeeiagvinnalekhfppdlkltivaepgryyvasaftlavnviakkvtpgvq
    tdvgahaesnaqsfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgptc
    dgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvvsglpdhvvrel
    ksqks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1njjD (D:)
    ntrdalckkisgdpffvadlgdivrkhetwkkclprvtpfyavkcnddwrvlgtlaalgt
    gfdcasnteiqrvrgigvppekiiyanpckqishiryardsgvdvmtfdcvdelekvakt
    hpkakmvlristvkfgakvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisds
    rfvfdmgtelgfnmhildigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaep
    gryyvasaftlavnviakkvtsnaqsfmyyvndgvygsfncilydhavvrplpqrepipn
    eklypssvwgptcdgldqiveryylpemqvgewllfedmgaytvfqsptiyyvv