PDB entry 1njg

View 1njg on RCSB PDB site
Description: Nucleotide-free form of an Isolated E. coli Clamp Loader Gamma Subunit
Deposited on 2002-12-30, released 2003-04-01
The last revision prior to the SCOP 1.71 freeze date was dated 2003-04-01, with a file datestamp of 2003-04-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.238
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1njga_
  • Chain 'B':
    Domains in SCOP 1.71: d1njgb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1njgA (A:)
    gahmggsmsyqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgkts
    iarllakglncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqy
    apargrfkvylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqf
    hlkaldveqirhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvs
    tqavsamlgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1njgA (A:)
    qvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakgln
    cetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvy
    lidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqi
    rhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlgt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1njgB (B:)
    gahmggsmsyqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgkts
    iarllakglncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqy
    apargrfkvylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqf
    hlkaldveqirhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvs
    tqavsamlgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1njgB (B:)
    vlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakglnc
    etgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvyl
    idevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqir
    hqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlgt