PDB entry 1njf

View 1njf on RCSB PDB site
Description: Nucleotide bound form of an isolated E. coli clamp loader gamma subunit
Deposited on 2002-12-30, released 2003-04-08
The last revision prior to the SCOP 1.71 freeze date was dated 2003-04-08, with a file datestamp of 2003-04-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.21
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1njfa_
  • Chain 'B':
    Domains in SCOP 1.71: d1njfb_
  • Chain 'C':
    Domains in SCOP 1.71: d1njfc_
  • Chain 'D':
    Domains in SCOP 1.71: d1njfd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1njfA (A:)
    gahmggsmsyqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgkts
    iarllakglncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqy
    apargrfkvylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqf
    hlkaldveqirhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvs
    tqavsamlgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1njfA (A:)
    vlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakglnc
    etgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvyl
    idevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqir
    hqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlgt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1njfB (B:)
    gahmggsmsyqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgkts
    iarllakglncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqy
    apargrfkvylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqf
    hlkaldveqirhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvs
    tqavsamlgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1njfB (B:)
    vlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakglnc
    etgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvyl
    idevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqir
    hqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlgt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1njfC (C:)
    gahmggsmsyqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgkts
    iarllakglncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqy
    apargrfkvylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqf
    hlkaldveqirhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvs
    tqavsamlgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1njfC (C:)
    vlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakglnc
    etgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvyl
    idevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqir
    hqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlgt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1njfD (D:)
    gahmggsmsyqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgkts
    iarllakglncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqy
    apargrfkvylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqf
    hlkaldveqirhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvs
    tqavsamlgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1njfD (D:)
    vlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakglnc
    etgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvyl
    idevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqir
    hqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlgt