PDB entry 1njf

View 1njf on RCSB PDB site
Description: Nucleotide bound form of an isolated E. coli clamp loader gamma subunit
Class: transferase
Keywords: protein-nucleotide complex, Rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, TRANSFERASE
Deposited on 2002-12-30, released 2003-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-07, with a file datestamp of 2012-03-02.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.21
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase III subunit gamma
    Species: Escherichia coli [TaxId:562]
    Gene: DnaX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1njfa_
  • Chain 'B':
    Compound: DNA polymerase III subunit gamma
    Species: Escherichia coli [TaxId:562]
    Gene: DnaX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1njfb_
  • Chain 'C':
    Compound: DNA polymerase III subunit gamma
    Species: Escherichia coli [TaxId:562]
    Gene: DnaX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1njfc_
  • Chain 'D':
    Compound: DNA polymerase III subunit gamma
    Species: Escherichia coli [TaxId:562]
    Gene: DnaX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1njfd_
  • Heterogens: ZN, AGS, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1njfA (A:)
    gahmggsmsyqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgkts
    iarllakglncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqy
    apargrfkvylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqf
    hlkaldveqirhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvs
    tqavsamlgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1njfA (A:)
    vlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakglnc
    etgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvyl
    idevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqir
    hqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlgt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1njfB (B:)
    gahmggsmsyqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgkts
    iarllakglncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqy
    apargrfkvylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqf
    hlkaldveqirhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvs
    tqavsamlgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1njfB (B:)
    vlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakglnc
    etgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvyl
    idevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqir
    hqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlgt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1njfC (C:)
    gahmggsmsyqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgkts
    iarllakglncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqy
    apargrfkvylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqf
    hlkaldveqirhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvs
    tqavsamlgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1njfC (C:)
    vlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakglnc
    etgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvyl
    idevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqir
    hqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlgt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1njfD (D:)
    gahmggsmsyqvlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgkts
    iarllakglncetgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqy
    apargrfkvylidevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqf
    hlkaldveqirhqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvs
    tqavsamlgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1njfD (D:)
    vlarkwrpqtfadvvgqehvltalanglslgrihhaylfsgtrgvgktsiarllakglnc
    etgitatpcgvcdncreieqgrfvdlieidaasrtkvedtrdlldnvqyapargrfkvyl
    idevhmlsrhsfnallktleeppehvkfllattdpqklpvtilsrclqfhlkaldveqir
    hqlehilneehiahepralqllaraaegslrdalsltdqaiasgdgqvstqavsamlgt