PDB entry 1nj9

View 1nj9 on RCSB PDB site
Description: Cocaine hydrolytic antibody 15A10
Class: immune system
Keywords: immunoglobulin, IMMUNE SYSTEM
Deposited on 2002-12-30, released 2004-02-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.199
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin variable chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1NJ9 (0-211)
    Domains in SCOPe 2.01: d1nj9a1, d1nj9a2
  • Chain 'B':
    Compound: immunoglobulin heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1NJ9 (0-214)
    Domains in SCOPe 2.01: d1nj9b1, d1nj9b2
  • Chain 'H':
    Compound: immunoglobulin heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1NJ9 (0-214)
    Domains in SCOPe 2.01: d1nj9h1, d1nj9h2
  • Chain 'L':
    Compound: immunoglobulin variable chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1NJ9 (0-211)
    Domains in SCOPe 2.01: d1nj9l1, d1nj9l2
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nj9A (A:)
    qavvtqesalttspgetvtltcrsstgtitsdnyanwvqekpdhlfsgligvnnarppgv
    parfsgsltgdkavltitgaqtedeaiyfcalwysnhwvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarewerhssyscqvtheghtvekslsra
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nj9B (B:)
    evqlqqsgpelvkpgasvkvsckasgysftdynmywvkqnhgeslewiayidpsngdtfy
    nqkfqgkatvtldkssstafmhlnsltsedsavyycarggglfafwgqgtlvtvsakttp
    psvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
    ssvtvpssprpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nj9H (H:)
    evqlqqsgpelvkpgasvkvsckasgysftdynmywvkqnhgeslewiayidpsngdtfy
    nqkfqgkatvtldkssstafmhlnsltsedsavyycarggglfafwgqgtlvtvsakttp
    psvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
    ssvtvpssprpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nj9L (L:)
    qavvtqesalttspgetvtltcrsstgtitsdnyanwvqekpdhlfsgligvnnarppgv
    parfsgsltgdkavltitgaqtedeaiyfcalwysnhwvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarewerhssyscqvtheghtvekslsra